A practical reference on Heptapeptide: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-03-16 and is reviewed periodically as new material appears.
Reversed-phase high-performance liquid chromatography is the standard technique for estimating peptide purity. The result is a peak-area percentage, which describes how much of the detected material elutes as the main peak in one run. Mass spectrometry confirms the molecular mass and can reveal truncated, adducted, or otherwise modified species. Amino acid analysis or tandem mass spectrometry can address sequence fidelity when identity is in doubt. None of these measurements, taken alone, establishes that a sample is fit for any specific purpose.
Lyophilized selank is normally supplied as a dry powder and is considered stable for extended periods when kept cold and dry. Moisture uptake is the main practical threat, because absorbed water promotes both hydrolysis and aggregation in the solid state. Vials are usually warmed to room temperature before opening so that condensation does not form on the powder. Supplier documentation commonly specifies -20 °C for routine storage, with -80 °C used for material intended to be archived for years.
Once dissolved, the peptide is markedly less stable than the dry powder. Aqueous solutions are subject to backbone hydrolysis and to microbial growth when they are handled without sterile technique. Buffered solutions near neutral pH are common for short-term laboratory work, while acidic conditions are sometimes used to improve solubility. Analytical laboratories generally prepare working solutions fresh rather than storing them, and a residual water film left in a reopened vial can seed degradation even when the container appears dry.
Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.
Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.
Reported activity for Selank centers on anxiolytic and nootropic effects. Russian clinical reports describe use in anxiety and in cognitive or attention-related complaints. Most of this evidence comes from studies conducted by the same research groups that developed the peptide. Independent replication in other countries remains limited, and no major Western regulatory agency has approved the compound for any indication. The gap between local reports and external verification is a recurring point in discussions of the peptide.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95 percent or higher by RP-HPLC | Area percentage of the main peak |
| Identity confirmation | Electrospray ionization mass spectrometry | Observed mass compared with the theoretical value near 751.9 Da |
| Recommended dry storage | -20 °C, desiccated | -80 °C for multi-year archival material |
| Solution handling | Prepare fresh; avoid long storage | Sterile filtration reduces microbial load |
| Common synonyms | TKPRPGP; TP-7 | Sequence code and laboratory designation used interchangeably |
Regulatory status differs sharply by region. Selank holds a Russian marketing authorization, where it is supplied mainly as nasal drops, while authorities elsewhere have not approved it for medical use. Material sold internationally is therefore usually labeled as a research chemical rather than a medicine. Peer-reviewed publications come predominantly from Russian laboratories, and sample sizes are generally small. Whether the compound produces comparable effects under independent, well-controlled replication remains an open question that the broader literature has not settled.
Selank is a synthetic heptapeptide developed in Russia as a structural analogue of tuftsin, a naturally occurring immunomodulatory tetrapeptide. Its sequence, Thr-Lys-Pro-Arg-Pro-Gly-Pro, keeps the tuftsin core at the N-terminus and appends a Pro-Gly-Pro tail. Researchers at the Institute of Molecular Genetics in Moscow synthesized the compound during the 1990s while searching for peptides with combined anxiolytic and immunomodulatory activity. The added tail was intended to resist enzymatic cleavage and prolong the molecule's presence in circulation.
The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.
Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.
Proposed mechanisms centre on modulation of the GABAergic system, with reports of altered expression of genes related to GABA-A receptor subunits and changed monoamine turnover. Some studies describe inhibition of enkephalinase, the enzyme that degrades endogenous enkephalins, which may prolong opioid peptide signalling. Effects on brain-derived neurotrophic factor and on cytokine expression have also been reported. These findings come largely from animal models and small human studies, and the precise primary target remains unresolved.
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.
The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.
Pharmacokinetic data are sparse and largely derived from animal work. After intranasal administration the peptide appears in plasma within minutes, and reported half-lives are short, on the order of minutes to tens of minutes. Degradation proceeds through ordinary proteolytic cleavage into constituent amino acids and smaller fragments. Direct evidence that intact Selank reaches brain tissue in meaningful amounts is limited, and the extent of blood-brain barrier penetration is debated. Some authors argue that fragments, not the parent peptide, carry much of the observed activity.
Published clinical work is concentrated in Russian-language journals and generally involves small samples without independent replication. Systematic reviews in English note the shortage of randomised, placebo-controlled trials and the difficulty of verifying methods from translated reports. Outcome measures vary between studies, which complicates pooling of results. Interest in the compound as a cognitive or anxiolytic agent therefore rests on a thinner evidence base than the volume of citations suggests. Replication in well-powered trials with preregistered endpoints would be needed before firm conclusions about efficacy can be drawn.
Proposed mechanisms centre on the GABAergic system. Animal and tissue studies report changes in GABA-A receptor expression and reduced activity of GABA transaminase, the enzyme that degrades GABA. Effects on monoamine turnover, including serotonin and dopamine pathways, are also described, and a separate line of work links the peptide to increased expression of brain-derived neurotrophic factor in hippocampal tissue. Most of these findings come from rodent models and cell preparations. How the individual observations combine into a single coherent mode of action is not settled.
=== Subsidy reforms and economic policies === The Iranian government has, at times, cut subsidies on essential goods or tried to reform the subsidy system to address budget deficits. These changes often lead to sudden price hikes in food items. The subsidies have been replaced with in-kind transfers. For several decades, the Iranian government has regulated the prices of over 20 essential goods. These prices, known as administered prices, are determined by the Consumer and Producer Protection Organization (CPPO) in collaboration with the Iranian Parliament. The CPPO sets consumer prices below both reference (border) prices and producer prices, with the government budget absorbing the resulting financial gap. In 2007, food subsidies represented approximately 2.8 percent of Iran's GDP. These subsidies are primarily directed toward cereals, which account for 50 percent of the total, while other basic food items such as sugar, cooking oils, and baby formulas comprise an additional 25 percent. The remaining 25 percent is allocated to various goods, including paper, agricultural machinery, fertilizers, and pharmaceuticals. As part of the Targeted Subsidies Reform, the government raised bread prices by as much as 25 percent in December 2010. After this adjustment, the CPPO prohibited any further price increases and instituted regular market inspections to prevent public unrest that could arise from inflationary pressures.
==== Vice President JD Vance ==== Trump's administration has also expressed cultural disagreement with Europe and the European Union: in a speech at the 61st Munich Security Conference, Vice President Vance criticized European policies on free speech and democratic values, and accused European leaders of suppressing dissenting views on issues such as immigration. Vance also expressed support for lifting restrictions on the Alternative for Germany, a far-right German political party.
=== Filtration === Chitosan can be used in hydrology as a part of a filtration process. Chitosan causes the fine sediment particles to bind together, and is subsequently removed with the sediment during sand filtration. It also removes heavy minerals, dyes, and oils from the water. As an additive in water filtration, chitosan combined with sand filtration removes up to 99% of turbidity. Chitosan is among the biological adsorbents used for heavy metals removal without negative environmental impacts. Chitosan is used to flocculate algal blooms in ponds and lakes due to the cyanobacteria possessing a negatively-charged cell wall which binds to the cationic chitosan polymer. In combination with bentonite, gelatin, silica gel, isinglass, or other fining agents, it is used to clarify wine, mead, and beer. Added late in the brewing process, chitosan improves flocculation, and removes yeast cells, fruit particles, and other detritus that cause hazy wine.
The world's agrifood systems comprise a gargantuan global enterprise that each year produces approximately 11 billion tonnes of food and a multitude of non-food products, including 32 million tonnes of natural fibres and 4 billion m3 of wood. The estimated gross value of agricultural output in 2018 was US$3.5 trillion. Agrifood systems employment represented 39.1% of global employment in 2022, down from 52.2% in 2000. In 2021 primary production alone provides about one-quarter of all employment globally, more than half in sub-Saharan Africa and almost 60 percent in low-income countries. Including middle and downstream segments – from food storage and processing to transportation, retailing and consumption – agrifood systems are the backbone of many economies. Even in the European Union, the food and beverage industry employs more people than any other manufacturing sector.FAO approximates that 1.23 billion people are employed globally in agrifood systems, amounting to about one-third of the global labor force.
==== Syncytium formation and direct cell-to-cell infection transmission ==== Two of SeV proteins: HA and F, after their binding directly to a cellular membrane, promote a cell-cell fusion, which leads to a large multinuclear cell formation (syncytium). This formation involves the fusion of infected cells with adjacent target cells and remains an important mechanism of direct cell-to-cell spread of viral components. Thus, a SeV infection in a form of genetic material in partially assembled virions can spread without any exposure to host neutralizing antibodies (see the section "Directed cells fusion (syncytium formation)" for details and references).
Sources: en.wikipedia.org
== Symptoms and signs == PIH manifests as areas of increased pigmentation or darkened skin. The color can range from light brown to deep brown or grey to black. Individuals with darker skin typically develop lesions that are darker and last longer compared to people with lighter skin color. Without any treatment, PIH usually fades in the 6-12 months following its appearance, until it is no longer visible. Postinflammatory hyperpigmentation (PIH) and postinflammatory erythema (PIE) are related but biologically different outcomes of skin inflammation. PIH happens because cytokines stimulate melanocytes, leading to more melanin production and brown or gray discoloration. This is especially common in people with darker skin types. In contrast, PIE shows up as persistent red or pink spots caused by superficial blood vessel dilation rather than pigment deposition, and it is more often seen in people with lighter skin types. Although both may occur after acne or other types of inflammation, PIH usually responds well to treatments that target pigment, while PIE is better treated with methods that focus on blood vessels, like pulsed-dye laser.
== Industrial collaborations == Brenner is a former member of the Scientific Advisory Board of Sirtris Pharmaceuticals. He currently serves as chief scientific advisor of Niagen Bioscience and NADMED.
Globally, as of 2010, approximately 250 million people had osteoarthritis of the knee (3.6% of the population). Hip osteoarthritis affects about 0.85% of the population. As of 2004, osteoarthritis globally causes moderate to severe disability in 43.4 million people. Together, knee and hip osteoarthritis had a ranking for disability globally of 11th among 291 disease conditions assessed.
Datura arenicola Gentry ex Bye & Luna Datura ceratocaula Ortega Datura discolor Bernh. Datura ferox L. Datura innoxia Mill. Datura kymatocarpa Barclay Datura lanosa A.S.Barclay ex Bye Datura leichhardtii Benth. Datura metel L. Datura pruinosa Greenm. Datura quercifolia Kunth Datura reburra Barclay Datura stramonium L. Datura wrightii Regel Of the above, D. leichhardtii is close enough to D. pruinosa to merit demotion to a subspecies and likewise D. ferox and D. quercifolia are close enough in morphology to merit being subsumed in a single species. Furthermore, the Australian provenance of D. leichhardtii, the Chinese provenance of D. ferox, and the Afro-Asiatic provenance of D. metel have been cast into serious doubt, with the three species being almost certainly post-Columbian introductions to the regions to which they were originally thought native. The case of D. metel is unique in that not only is the plant not a true species at all, but an assemblage of ancient pre-Columbian cultivars created from D. innoxia in the Greater Antilles, but evidence is mounting that it was introduced to the Indian subcontinent no later than the second century CE—whether by natural or human agency is, as yet, unknown—making it one of the most ancient plant introductions (if not the most ancient) from the New World to the Old World (see Columbian Exchange). D. arenicola is a recently discovered species, described first in 2013, of very restricted range, and so distinctive as to have merited the creation for it of the new section Discola [not to be confused with the species name D.
== Technology == Passport Carrier Release, telecommunications software Peak cell rate, on ATM networks Platform Configuration Register, a Trusted Execution Technology implemented using a TPM Program clock reference, in MPEG transport streams XM PCR, a satellite receiver
Sources: en.wikipedia.org
Primary and Intermediate education was conducted in Arabic while Secondary and independent schools conducted their lessons in Arabic, English, Urdu, Hebrew and Gujarati. There were also Quranic schools for both boys and girls, but these were unrecognised.
=== Genome size === Genome size is a fundamental characteristic of an organism. Ants have been found to have tiny genomes, with the evolution of genome size suggested to occur through loss and accumulation of non-coding regions, mainly transposable elements, and occasionally by whole genome duplication. This may be related to colonisation processes, but further studies are needed to verify this.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Mesenchyme () is a type of loosely organized animal embryonic connective tissue of undifferentiated cells that give rise to many tissues, such as skin, blood, or bone. The interactions between mesenchyme and epithelium help to form nearly every organ in the developing embryo.
== External links == Media related to Chocolate at Wikimedia Commons Quotations related to Chocolate at Wikiquote The dictionary definition of chocolate at Wiktionary Cookbook:Chocolate at Wikibooks Works related to Portal:Chocolate at Wikisource Chocolate travel guide from Wikivoyage
Sources: en.wikipedia.org
Sealed, desiccated storage at -20 °C or colder is the standard recommendation for research-grade material. Vials should reach room temperature before they are opened, which limits condensation. Repeated temperature cycling is discouraged.
A reported purity value reflects the share of the main peak in one chromatographic run and says nothing about identity. Confirming that the expected sequence is present requires a separate measurement such as mass spectrometry. Purity and identity are distinct questions.
A mass spectrum reports the molecular masses present in a sample and shows whether they match the value expected for selank, near 751.9 Da. It also flags common artifacts such as truncation or adduct formation. It does not establish correct stereochemistry or complete sequence order on its own.
Selank is a synthetic peptide made of seven amino acids. It is modeled on tuftsin, a natural tetrapeptide, with an added three-residue tail. It is not a small-molecule drug.