nootropic is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-02-13. Numbers and descriptions here follow the published literature rather than marketing material.
Peptide stability depends strongly on temperature, moisture, and pH. Lyophilized Selank is generally most stable when stored cold and dry, with freezer temperatures commonly used for long-term storage. In solution, the compound is susceptible to hydrolysis and to microbial growth if it is not handled aseptically. The C-terminal proline-rich extension appears to slow enzymatic cleavage relative to tuftsin, though quantitative degradation rates vary with the matrix and the conditions tested. Published stability data specific to Selank remain sparse.
Quality assessment of Selank samples typically combines purity determination with identity confirmation and counter-ion analysis. Purity is usually reported as a percentage by chromatographic area, with values above 95 percent often quoted for research-grade material. Water content and residual solvents are checked in lyophilized batches because they affect both stability and accurate mass determination. A reported purity figure does not by itself establish that a sample is the intended sequence, so orthogonal methods are needed to rule out sequence isomers or truncation products.
Characterization of Selank in laboratory settings relies on standard peptide analytical techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and degradation products, while mass spectrometry confirms molecular identity through accurate mass measurement. Amino acid analysis and peptide sequencing verify the primary structure when reference material is unavailable. Because Selank is a short chain, fragmentation-based analysis produces a diagnostic ion pattern that supports confident identification.
Enzymatic stability motivates the extra three residues at the carboxyl end. Native tuftsin is cleaved quickly by circulating aminopeptidases and carboxypeptidases, which limits its duration of action and its usefulness as a tool compound. Extending the chain with proline-rich segments is a common design tactic because proline constrains the backbone and slows proteolysis. The same Pro-Gly-Pro motif appears in other Russian-developed peptides of the era. Whether the full seven-residue chain is required for activity, or whether it acts mainly as a prodrug releasing tuftsin, remains unresolved.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. Its four N-terminal residues reproduce tuftsin, a tetrapeptide fragment of the immunoglobulin heavy chain, while the C-terminal Pro-Gly-Pro extension is a synthetic addition. The peptide has a molecular mass near 752 daltons and carries a net positive charge at physiological pH because of the arginine and lysine side chains. Published indexes list it under the name Selank and the sequence abbreviation TKPRPGP. Solid-phase peptide synthesis is the standard production route for research quantities.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For lyophilized powder, long term |
| Common analytical method | Reverse-phase HPLC | Usually paired with mass spectrometry |
| Typical reported purity | At or above 95 percent by area | Research-grade material |
| Aqueous solubility | High | Solutions used in laboratory assays |
| Moisture sensitivity | Hydrolyzes in solution | Aseptic handling reduces degradation |
Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.
Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.
The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.
Naming conventions place Selank in the same research family as Semax, another Russian-developed peptide investigated for cognitive effects. The two compounds share a lineage but differ in sequence and in the biological systems proposed as their targets. Semax descends from ACTH fragments, whereas Selank descends from tuftsin. Publications sometimes identify Selank by its full peptide sequence or by laboratory codes rather than one uniform trade name. Because replication outside Russia is limited, reports on its properties are best read alongside the study design and the purity of the material tested.
Selank is a synthetic heptapeptide developed in Russia during the 1990s. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences designed it as a stabilized analog of tuftsin, a naturally occurring immunomodulatory tetrapeptide. The compound has been studied primarily for its reported anxiolytic and nootropic effects. It remains largely unknown in Western pharmacology and is not approved as a medicine by major regulators such as the FDA or the EMA.
Dry powder is normally held at -20 degrees Celsius or lower, in a sealed container with desiccant and protection from light. Reconstituted solutions are usually kept at 2 to 8 degrees Celsius for short periods and frozen for longer ones. Proline residues at several positions are generally associated with some resistance to peptidase attack, but chemical stability still declines at neutral to alkaline pH and at elevated temperature. Exact shelf-life figures are product-specific and are not standardised across suppliers.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, with mass spectrometry used to confirm molecular mass and sequence information. Amino acid analysis and peptide mapping may supplement these methods. Certified reference standards are scarce, and many commercial lots are sold as research chemicals without a pharmacopoeial monograph. Regulatory treatment differs by country: Selank is a registered prescription medicine in Russia, while in the European Union and the United States it is not an approved drug and may fall under research-chemical or unapproved-product frameworks.
==== Pollination ==== Fertilization of the ovule occurs through wind pollination, via motile sperm, as in cycads, ferns, mosses, and algae. The sperm are large (about 70–90 μm) and are similar to the sperm of cycads, which are slightly larger. Ginkgo sperm were first discovered by the Japanese botanist Sakugoro Hirase in 1896. The sperm have a complex multi-layered structure, which is a continuous belt of basal bodies that form the base of several thousand flagella which have a cilia-like motion. The flagella/cilia apparatus pulls the body of the sperm forwards. The sperm have only a tiny distance to travel to the archegonia, of which there are usually two or three. Two sperm are produced, one of which successfully fertilizes the ovule. Fertilization of ginkgo ovules, and development of the embryos, occurs just before or after they fall from the tree in early autumn .
Engineers have been able to successfully incorporate the AceA and AceB genes into mammalian cells in culture, and the cells were successful in translating and transcribing the genes into the appropriate enzymes, proving that the genes could successfully be incorporated into the cell's DNA without damaging the functionality or health of the cell. However, being able to engineer the pathway into transgenic mice has proven to be difficult for engineers. While the DNA has been expressed in some tissues, including the liver and small intestine in test animals, the level of expression is not high, and not found to be statistically significant. In order to successfully engineer the pathway, engineers would have to fuse the gene with promoters which could be regulated in order to increase the level of expression, and have the expression in the right cells, such as epithelial cells. Efforts to engineer the pathway into more complex animals, such as sheep, have not been effective. This illustrates that much more research needs to be done on the topic, and suggests it is possible that a high expression of the cycle in animals would not be tolerated by the chemistry of the cell. Incorporating the cycle into mammals will benefit from advances in nuclear transfer technology, which will enable engineers to examine and access the pathway for functional integration within the genome before its transfer to animals. There are possible benefits, however, to the cycle's absence in mammalian cells.
Attempting to assert his claimed prerogatives as Her Majesty's Rhodesian Prime Minister, Smith advised the Queen by letter to appoint Dupont as Governor-General to supersede Gibbs. The letter was ignored, with Buckingham Palace characterising Smith's request as "purported advice". Whitehall maintained that Gibbs was the Queen's only legitimate representative in what it still reckoned as the colony of Southern Rhodesia–and hence, the only lawful authority in the area. Dupont nevertheless effectively replaced the Governor. The Smith administration assigned him the Governor's official residence at Government House, but no attempt was made to forcibly remove Gibbs and his entourage; the post-UDI government stated that the Officer Administering the Government would live at Governor's Lodge instead "until Government House, at present temporarily occupied by Sir Humphrey Gibbs in a private capacity, becomes available". The Speaker of the Rhodesian parliament, A. R. W. Stumbles, reconvened the Legislative Assembly on 25 November, resolving that if he did not there would be chaos. He feared that Gibbs might dramatically walk into the chamber in an attempt to stop the proceedings, but Gibbs did no such thing. The parliamentary opposition opened the meeting by asking whether the assembly was legal. Ahrn Palley, the lone white opposition MP, announced that as he saw it, "certain Honourable Members in collusion have torn up the constitution under which this House meets. The proceedings have no legal validity whatsoever".
parietina has more limited genetic exchange between nearby populations than previously thought, possibly due to habitat specialization. Molecular investigations into the mating-type (MAT) loci have further revealed the reproductive strategies within Xanthoria. While X. parietina is homothallic—possessing only a MAT1-2 gene (although truncated)—species such as X. polycarpa are heterothallic, with distinct MAT idiomorphs (different mating-type genetic regions). These differences in mating system structure can significantly affect population genetics, influencing levels of genetic diversity, gene flow, and ultimately speciation processes within the genus.
== Side effects == Common side effects with pseudoephedrine therapy may include central nervous system (CNS) stimulation, insomnia, restlessness, excitability, dizziness, and anxiety. Infrequent side effects include tachycardia or palpitations. Rarely, pseudoephedrine therapy may be associated with mydriasis (dilated pupils), hallucinations, arrhythmias, hypertension, seizures, and ischemic colitis; as well as severe skin reactions known as recurrent pseudo-scarlatina, systemic contact dermatitis, and non-pigmenting fixed drug eruption. Pseudoephedrine, particularly when combined with other drugs including narcotics, may also play a role in the precipitation of episodes of psychosis. It has also been reported that pseudoephedrine, among other sympathomimetic agents, may be associated with the occurrence of hemorrhagic stroke and other cardiovascular complications. Due to its sympathomimetic effects, pseudoephedrine is a vasoconstrictor and pressor agent (increases blood pressure), a positive chronotrope (increases heart rate), and a positive inotrope (increases force of heart contractions). The influence of pseudoephedrine on blood pressure at clinical doses is controversial. A closely related sympathomimetic and decongestant, phenylpropanolamine, was withdrawn due to associations with markedly increased blood pressure and incidence of hemorrhagic stroke. There has been concern that pseudoephedrine may likewise dangerously increase blood pressure and thereby increase the risk of stroke, whereas others have contended that the risks are exaggerated.
Sources: en.wikipedia.org
After synthesizing and purifying the core, the carbohydrate layer is added to its surface. Common coating materials are typically polyhydroxy oligomers such as cellobiose, citrate, lactose, and sucrose. This layer seems to be important for the properties of aquasomes, as it influences several drug characteristics including adsorption, molecular stability, and conformation (shape), and acts as a dehydroprotectant. The addition of the carbohydrate layer to the surface of the nanocrystalline core is commonly carried out by passive adsorption through incubation and sonication. Similar to the processing of the core, the carbohydrate layer is subjected to centrifugation, washing, and further sonification followed by heated air drying. Finally, the bioactive molecule of interest is loaded into the carbohydrate layer. This process typically occurs through either lyophilization or passive adsorption, and the fully functionalized aquasome is then characterized.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Encapsulin shells compromise icosahedral complexes (12 vertices, 20 faces, 30 edges) formed as a result of self-assembly of protomers. These encapsulin shells have diameters between 24 and 42 nm and are defined by the HK97-fold of their shell protein. The HK97-fold protomer has a roughly triangular shape and consists of three conserved domains: the axial domain, the peripheral domain, and the extended loop. The size and symmetry of the capsid are defined by a triangulation number (T), which determines the number of subunits in the assembly. For example: T = 1 encapsulins (Thermotoga martima) consist of 60 protomers. T = 3 encapsulins (Pyrococcus furiosus) consist of 180 protomers. T = 4 encapsulins (Quasibacillus thermotolerans) consist of 240 protomers.
The only stable yttrium isotope, 89Y, will be found with yield somewhat less than 1% in a fission product mixture which has been allowed to age for months or years, as the next-longest lived yttrium isotopes have half-lives of only 107 days (88Y) or 59 days (91Y). However, a small amount of yttrium-90 will be found in secular equilibrium with its parent strontium-90 unless the two elements are separated from each other. 90Sr decays into 90Y which is a beta emitter with a half-life of 2.67 days. 90Y is sometimes used for medical purposes and can be obtained either by the neutron activation of stable 89Y or by using a device similar to a technetium cow. As the half-lives of the unstable yttrium isotopes are low (88Y being the longest at 106 days), yttrium extracted from strontium-free moderately aged spent fuel has negligible radioactivity. However, the strong gamma emitter 90Y will be present as long as its parent nuclide 90Sr is. Should a nonradioactive sample of yttrium be desired, care must be taken to remove all traces of strontium and sufficient time to let the short lived Y-90 (64 hours half-life) decay must be allowed before the product can be used.
10 July Dynamic shell formation is demonstrated experimentally for the first time. Researchers claim their technique is a feasible target for mass production of fusion energy. The highest albedo ever measured for an exoplanet is confirmed using data from the CHEOPS space telescope. The ultra-hot Neptune LTT 9779 b is shown to reflect 80% of incoming light from its star (compared to 75% for Venus), due to the high metal content of its clouds. 11 July Three possible "dark star" candidates are reported, at times ranging from about 320 million to 400 million years after the Big Bang, based on analysis of observations by the James Webb Space Telescope Berkeley Earth reports that June 2023 was the warmest June since records began in 1850, and broke the previous record by 0.18 °C. Its temperature dataset suggests that 2023 is now 81% likely to become a new record year for global warming. A study suggests that carbon taxation approaches or instruments would be more effective and fairer when distinguishing between luxury- and basic goods and services. A separate study (17 July) finds that for energy demand reduction (EDR), "capping energy use of the top quintile of consumers" would be effective, more equitable, and increase public acceptance of transformative climate action in Europe. 12 July Astronomers report considerable success of the James Webb Space Telescope (JWST) after its first year of operations.
Sources: en.wikipedia.org
Homosexual acts are prohibited by law in Ghana. According to a 2013 survey by the Pew Research Center, 96% of Ghanaians believe that homosexuality should not be accepted by society. In 2026 further laws were introduced creating a duty to report homosexual acts and to criminalise "supporters" of LGBTQ+ people. Sometimes elderly women in Ghana are accused of witchcraft, particularly in rural Ghana. Issues of witchcraft mainly remain as speculations based on superstitions within families. In some parts of northern Ghana witch camps exist. These are said to house a total of around 1,000 people accused of and ostracised for witchcraft. The Ghanaian government announced that it intended to close the camps. Over a decade later, in 2023, the Anti-Witchcraft bill passed in parliament, to address accusations and the social impacts of being accused of being a witch, and the president refused to sign it into law. The legislation was reintroduced in 2025.
== History == Frederick William Hope coined the term myiasis in 1840 to refer to diseases resulting from dipterous larvae as opposed to those caused by other insect larvae (the term for this was scholechiasis). Hope described several cases of myiasis from Jamaica caused by unknown larvae, one of which resulted in death. Even though the term myiasis was first used in 1840, such conditions have been known since ancient times. Ambroise Paré, the chief surgeon to King Charles IX and King Henry III, observed that maggots often infested open wounds.
The water absorption of aluminium and palladium becomes an unacceptable source of outgassing, and even the adsorptivity of hard metals such as stainless steel or titanium must be considered. Some oils and greases will boil off in extreme vacuums. The permeability of the metallic chamber walls may have to be considered, and the grain direction of the metallic flanges should be parallel to the flange face. The lowest pressures currently achievable in laboratory are about 1×10−13 torrs (13 pPa). However, pressures as low as 5×10−17 torrs (6.7 fPa) have been indirectly measured in a 4 K (−269.15 °C; −452.47 °F) cryogenic vacuum system. This corresponds to ≈100 particles/cm3.
English Defence League founder Tommy Robinson is charged by police with failing to comply with an order to stay away from the previous day's antisemitism march after attending the rally. 28 November An investigation by The Guardian finds that potentially toxic "forever chemicals" are present in the drinking water sources at 17 of the 18 water companies in England. Virgin Atlantic launches the world's first transatlantic flight by a large passenger plane using 100% sustainable aviation fuel. The passengerless journey is made by a Boeing 787 travelling from London Heathrow to New York. 29 November The coldest November night since 2010 is experienced by many parts of the UK, reaching as low as −8 °C (18 °F) in Aonach Mòr in the Scottish Highlands, with snow and ice warnings for various regions extending to Friday. Natural England announces that England will be getting a new National Park. The Chilterns, The Cotswolds and Dorset could become new National Parks. Nottingham City Council declares itself effectively bankrupt, with a £23m overspend forecast for the 2023–24 financial year. At Prime Minister's Questions, Sunak accuses the Greek prime minister of trying to "grandstand" over the Elgin Marbles when questioned about his decision to cancel a planned meeting with Mitsotakis. 30 November Matt Hancock, who served as health secretary from 2018 to 2021, appears at the latest stage of the COVID-19 inquiry. RMT members vote to accept a pay deal from 14 train companies, which ends a long-running series of strikes until at least spring 2024.
Sources: en.wikipedia.org
The most common approach combines reverse-phase liquid chromatography with mass spectrometry. Chromatography separates the components while mass spectrometry confirms the molecular mass. Peptide sequencing or tandem mass analysis can further verify the amino acid order.
Lyophilized powder is usually kept frozen and protected from moisture. Solutions are less stable and are often used promptly or divided into aliquots to avoid repeated freeze-thaw cycles. Exact shelf-life values depend on purity and handling.
No. A purity figure derived from chromatographic area does not prove the amino acid sequence. Identity requires an orthogonal method such as mass spectrometry or sequencing. Truncated or isomerized peptides can co-elute with the target compound.
Selank is a seven-amino-acid peptide built from the tuftsin sequence plus a Pro-Gly-Pro tail. It is produced by chemical synthesis rather than extracted from a natural source. The free peptide is usually supplied as a lyophilised powder or in an aqueous formulation.