en · de · pt
selank-notes.peptides4962.com › Guide › Selank Background And Peptide Chemistry — Worked Examples

Selank Background And Peptide Chemistry — Worked Examples

By Editorial Desk · published 2026-05-25 · last reviewed 2026-06-10 · Guide

The short version of peptidase fits in a sentence. The long version — which is the one that helps — is below.

Reviewed 2026-06-10. Anything still debated is marked as such rather than presented as settled.

Selank Background and Peptide Chemistry

Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.

Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.

Stability, Handling, and Analytical Control

Peptide bonds are vulnerable to protease attack, and Selank is no exception. Measured half-life in serum is short, on the order of minutes in several reports, which explains why intranasal administration is the common route described in the literature. Absorption across the nasal mucosa partially bypasses first-pass hepatic metabolism. Quantitative data on human bioavailability remain limited and are difficult to compare across studies.

Lyophilised material kept dry at minus 20 degrees Celsius or colder is the most stable form, and suppliers commonly state a shelf life of two years or more under those conditions. Once dissolved, degradation accelerates through hydrolysis and deamidation, particularly at alkaline pH or elevated temperature. Working solutions are usually divided into single-use aliquots to avoid repeated freeze-thaw cycles. The choice of reconstitution solvent affects both stability and the ionic strength of the final preparation.

Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres is the standard purity method. Mass spectrometry, typically electrospray ionisation, confirms identity through the expected mass-to-charge pattern. Amino acid analysis can verify composition independently. Chiral purity requires separate techniques such as derivatisation followed by chromatographic separation, and such data are rarely reported for research-grade material.

Selank at a glance

PropertyValueNotes
Molecular formulaC33H57N11O9Derived from the seven-residue sequence
Molecular weightAbout 751.9 g/molAverage mass; the monoisotopic value is slightly lower
Residue countSeven amino acidsThr-Lys-Pro-Arg-Pro-Gly-Pro
Parent compoundTuftsin (Thr-Lys-Pro-Arg)Selank extends tuftsin at the C-terminus
Compound classSynthetic short peptideStudied in a research setting; not a licensed drug in most markets

Analytical Methods and Stability

Handling follows standard practice for research peptides. Material is weighed in a low-humidity environment because the powder absorbs atmospheric moisture. Purity is reported as the percentage area of the main peak in a chromatogram, with specifications commonly set at 95 percent or higher; values below that threshold indicate the presence of truncated or modified species. Residual trifluoroacetate from purification is often present and may affect mass balance. Certificates of analysis should state the analytical method, the column and gradient used, and the lot-specific retention time so that results can be compared across suppliers.

Identity and purity of selank are established with reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The peptide elutes from C18 columns with acetonitrile gradients in water containing trifluoroacetic acid or formic acid, and detection is usually performed by ultraviolet absorbance near 214 nm. Electrospray ionization in positive mode gives a doubly protonated ion near m/z 377, consistent with a mass of about 752 Da. Amino acid analysis or tandem mass spectrometry of fragment ions confirms the sequence. Because the molecule has no aromatic residues, it lacks a usable 280 nm chromophore, so low-wavelength detection or mass spectrometry is required.

Related pages on this site

Selank Origin and Chemical Identity

The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.

Regulatory status differs sharply by region. Selank holds a Russian marketing authorization, where it is supplied mainly as nasal drops, while authorities elsewhere have not approved it for medical use. Material sold internationally is therefore usually labeled as a research chemical rather than a medicine. Peer-reviewed publications come predominantly from Russian laboratories, and sample sizes are generally small. Whether the compound produces comparable effects under independent, well-controlled replication remains an open question that the broader literature has not settled.

Mechanism and Evidence Status

Published clinical work is concentrated in Russian-language journals and generally involves small samples without independent replication. Systematic reviews in English note the shortage of randomised, placebo-controlled trials and the difficulty of verifying methods from translated reports. Outcome measures vary between studies, which complicates pooling of results. Interest in the compound as a cognitive or anxiolytic agent therefore rests on a thinner evidence base than the volume of citations suggests. Replication in well-powered trials with preregistered endpoints would be needed before firm conclusions about efficacy can be drawn.

Proposed mechanisms centre on the GABAergic system. Animal and tissue studies report changes in GABA-A receptor expression and reduced activity of GABA transaminase, the enzyme that degrades GABA. Effects on monoamine turnover, including serotonin and dopamine pathways, are also described, and a separate line of work links the peptide to increased expression of brain-derived neurotrophic factor in hippocampal tissue. Most of these findings come from rodent models and cell preparations. How the individual observations combine into a single coherent mode of action is not settled.

Supporting material

Within the field of molecular biology, a protein-fragment complementation assay, or PCA, is a method for the identification and quantification of protein–protein interactions. In the PCA, the proteins of interest ("bait" and "prey") are each covalently linked to fragments of a third protein (e.g. DHFR, which acts as a "reporter"). Interaction between the bait and the prey proteins brings the fragments of the reporter protein in close proximity to allow them to form a functional reporter protein whose activity can be measured. This principle can be applied to many different reporter proteins and is also the basis for the yeast two-hybrid system, an archetypical PCA assay.

As of 2020, normal ALP levels were "not well defined", and there tend to be variations by sex and racial background, and by age, with children and adolescents having markedly higher levels. There are many possible explanations for elevated ALP. When the cause is unclear, isoenzyme studies using electrophoresis can confirm the source of the increase. Skelphosphatase (which is localized in osteoblasts and extracellular layers of newly synthesized matrix) is released into circulation by a yet unclear mechanism. Placental alkaline phosphatase is elevated in seminomas and active forms of rickets, as well as in the following diseases and conditions: Biliary obstruction Bone conditions Osteoblastic bone tumors Osteomalacia Osteoporosis Hepatitis Mononucleosis Cirrhosis Acute cholecystitis Myelofibrosis Leukemoid reaction Congestive heart failure Lymphoma Paget's disease Sarcoidosis Hyperthyroidism Hyperparathyroidism Myocardial infarction Cholangitis Ischemic cholangiopathy Pregnancy High doses of estrogens

UniProt is an online repository of protein sequence and annotation data, distributed in UniProt Knowledgebase (UniProt KB), UniProt Reference Clusters (UniRef) and UniProt Archive (UniParc) databases. Originally conceived as the individual ventures of EMBL-EBI, Swiss Institute of Bioinformatics (SIB) (together maintaining Swiss-Prot and TrEMBL) and Protein Information Resource (PIR) (housing Protein Sequence Database), the increase in the global protein data generation led to their collaboration in the creation of UniProt in 2002. The protein entries stored in UniProt are cataloged by a unique UniProt identifier. The annotation data collected for the each entry are organized in logical sections (e.g. protein function, structure, expression, sequence or relevant publications), allowing a coordinated overview about the protein of interest. Links to external databases and original sources of data are also provided. In addition to standard search by the protein name/identifier, UniProt webpage houses tools for BLAST searching, sequence alignment or searching for proteins containing specific peptides.

Camurus AB (publ) is a Swedish research-based pharmaceutical and biotechnology company specialising in the commercialization of medicines for treating serious and chronic diseases. Established in 1991 and based in the southern university city of Lund, in the Medicon Valley region, the company is listed on Nasdaq Stockholm, Mid Cap. Camurus was founded by scientists in biophysical, food, and pharmaceutical chemistry with expertise in lipid phase structures. The company provides nanoscale drug-delivery systems for development of high-value therapeutics.

Sources: en.wikipedia.org

Notes from published material

After synthesizing and purifying the core, the carbohydrate layer is added to its surface. Common coating materials are typically polyhydroxy oligomers such as cellobiose, citrate, lactose, and sucrose. This layer seems to be important for the properties of aquasomes, as it influences several drug characteristics including adsorption, molecular stability, and conformation (shape), and acts as a dehydroprotectant. The addition of the carbohydrate layer to the surface of the nanocrystalline core is commonly carried out by passive adsorption through incubation and sonication. Similar to the processing of the core, the carbohydrate layer is subjected to centrifugation, washing, and further sonification followed by heated air drying. Finally, the bioactive molecule of interest is loaded into the carbohydrate layer. This process typically occurs through either lyophilization or passive adsorption, and the fully functionalized aquasome is then characterized.

The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.

Encapsulin shells compromise icosahedral complexes (12 vertices, 20 faces, 30 edges) formed as a result of self-assembly of protomers. These encapsulin shells have diameters between 24 and 42 nm and are defined by the HK97-fold of their shell protein. The HK97-fold protomer has a roughly triangular shape and consists of three conserved domains: the axial domain, the peripheral domain, and the extended loop. The size and symmetry of the capsid are defined by a triangulation number (T), which determines the number of subunits in the assembly. For example: T = 1 encapsulins (Thermotoga martima) consist of 60 protomers. T = 3 encapsulins (Pyrococcus furiosus) consist of 180 protomers. T = 4 encapsulins (Quasibacillus thermotolerans) consist of 240 protomers.

The hepatocyte is a complex and multifunctional differentiated cell whose cell response will be influenced by the zone in hepatic lobule, because concentrations of oxygen and toxic substances present in the hepatic sinusoids change from periportal zone to centrilobular zone10. The hepatocytes of the intermediate zone have the appropriate morphological and functional features since they have the environment with average concentrations of oxygen and other substances. This specialized cell is capable of:

Carnitine is an essential cofactor for mitochondrial transport of long‑chain fatty acids (a major lipid class) into the matrix for β‑oxidation. gamma-aminobutyric acid is a neurotransmitter. 5-HTP (5-hydroxytryptophan) is used for experimental treatment of depression. L-DOPA (L-dihydroxyphenylalanine) for Parkinson's treatment, Eflornithine inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Canavanine, an analogue of arginine found in many legumes is an antifeedant, protecting the plant from predators. Mimosine found in some legumes, is another possible antifeedant. This compound is an analogue of tyrosine and can poison animals that graze on these plants. However, not all of the functions of other abundant nonstandard amino acids are known.

Sources: en.wikipedia.org

Further detail

Receptors bind with endogenous ligands to produce a physiological effect and regulate the body and cellular homeostasis. In a ligand-receptor interaction, the ligand binds with the receptors to form a drug-receptor complex, producing a biological response. The biological nature of receptors can be enzymes, nucleic acids or cellular proteins. Common types of receptors include G-protein coupled receptors, nuclear receptors and ion channels. Functional antagonists would not produce a biological response after binding with a receptor. It blocks the binding of endogenous ligands to the receptors and thus inhibits the subsequent physiological effect.

Tuberculin, known in its modern form as purified protein derivative (PPD), is a combination of proteins that are used in the diagnosis of tuberculosis by injection into the skin. Common side effects include redness, itchiness (pruritus), and pain at the site of injection. Allergic reactions may occasionally occur. Use is safe in pregnancy. The original tuberculin, a glycerin extract of Mycobacterium tuberculosis, was discovered in 1890 by Robert Koch. Koch, best known for his work on the etiology (cause, origin) of tuberculosis (TB), laid down various rigorous guidelines that aided the establishment between a pathogen and the specific disease that followed that were later named Koch's postulates. Although he initially believed it would cure tuberculosis, this was later disproved. PPD was invented in 1934 by Florence B. Seibert, greatly improving the reliability of the skin test over Koch's extract. PPD is on the World Health Organization's List of Essential Medicines.

Albert Pinhasov (Hebrew: אלברט פנחסוב; born 9 February 1972) is the Rector of Ariel University. He is a researcher in the fields of Molecular Psychiatry and Psychopharmacology.He also served as Vice President and Dean for Research & Development and the Head of the Department of Molecular Biology at Ariel University. Albert Pinhasov was born on 9 February 1972 in the city of Namangan, Uzbekistan. From 1990 to 1994, he studied at the Gorky Academy of Medicine, in the city of Nizhny Novgorod, Russia. In 1994, he immigrated to Israel where he continued his education at Tel Aviv University. He was awarded a Master of Science degree (MSc) in 1998 and a PhD in the field of Molecular Biology and Clinical Biochemistry under the mentorship of Illana Gozes in 2002 from Tel Aviv University.

n RCHNHC(O)OC(O) → [N(H)CH(R)CO)]n + n CO2 Poly-L-lysine has been prepared from N-carbobenzyloxy-α-N-carboxy-L-lysine anhydride, followed by deprotection with phosphonium iodide. Peptide synthesis from NCAs does not require protection of the amino acid functional groups. N-Substituted NCAs, such as sulfenamide derivatives have also been examined. The ring-opening polymerization of NCAs is catalyzed by metal catalysts. The polymerization of NCA’s have been considered as a prebiotic route to polypeptides. NCAs can also be used to form amides and lactams by reaction of carboxylic acids and isocyanates. Dakin–West reaction Glycine N-carboxyanhydride, the parent NCA

Sources: en.wikipedia.org

Frequently asked questions

What is selank?

Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, designed as a metabolically stabilized analogue of the endogenous tetrapeptide tuftsin. It has been studied mainly against anxiety-related and cognitive endpoints rather than as an approved medicine in most jurisdictions.

How does selank differ from tuftsin?

Tuftsin contains four residues, while selank carries an additional Pro-Gly-Pro segment at the carboxyl end. That extension is intended to reduce enzymatic cleavage. Comparative pharmacokinetic data in humans remain limited.

Is the mechanism of action established?

No single receptor target is widely accepted as the definitive mediator of the reported effects. Proposed contributors include GABAergic modulation, shifts in monoamine turnover, and altered neuropeptide degradation. The mechanism is treated in the literature as unresolved.

How should the powder be stored?

Dry powder is best kept sealed, protected from light, and held at minus 20 degrees Celsius or below. Desiccant packaging helps limit moisture uptake because the material is hygroscopic. A sealed vial should be allowed to equilibrate to room temperature before opening to reduce condensation.

Network